Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4433319..4434154 Replicon chromosome
Accession NZ_CP123240
Organism Escherichia coli strain YZLc1-3

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1M0VTI9
Locus tag N4725_RS21525 Protein ID WP_072649755.1
Coordinates 4433319..4433696 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7LDN9
Locus tag N4725_RS21530 Protein ID WP_001285607.1
Coordinates 4433786..4434154 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4725_RS21495 (4429500) 4429500..4431122 - 1623 WP_001295726.1 Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase -
N4725_RS21500 (4431355) 4431355..4431582 - 228 WP_024183600.1 hypothetical protein -
N4725_RS21505 (4431846) 4431846..4432022 - 177 Protein_4209 helix-turn-helix domain-containing protein -
N4725_RS21510 (4432389) 4432389..4432532 - 144 Protein_4210 hypothetical protein -
N4725_RS21515 (4432617) 4432617..4432814 - 198 WP_001327226.1 DUF957 domain-containing protein -
N4725_RS21520 (4432834) 4432834..4433322 - 489 WP_000761685.1 DUF5983 family protein -
N4725_RS21525 (4433319) 4433319..4433696 - 378 WP_072649755.1 TA system toxin CbtA family protein Toxin
N4725_RS21530 (4433786) 4433786..4434154 - 369 WP_001285607.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N4725_RS21535 (4434234) 4434234..4434455 - 222 WP_000692350.1 DUF987 domain-containing protein -
N4725_RS21540 (4434542) 4434542..4435018 - 477 WP_001384029.1 RadC family protein -
N4725_RS21545 (4435033) 4435033..4435518 - 486 WP_000213722.1 antirestriction protein -
N4725_RS21550 (4435610) 4435610..4436428 - 819 WP_001175175.1 DUF932 domain-containing protein -
N4725_RS21555 (4436518) 4436518..4436727 - 210 WP_032150870.1 DUF905 family protein -
N4725_RS21560 (4436757) 4436757..4437434 - 678 WP_001097301.1 hypothetical protein -
N4725_RS21565 (4437582) 4437582..4438262 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4423101..4452843 29742


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14216.18 Da        Isoelectric Point: 7.3523

>T278745 WP_072649755.1 NZ_CP123240:c4433696-4433319 [Escherichia coli]
MNTLPDTHVREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SVCTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPWAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13689.53 Da        Isoelectric Point: 6.4669

>AT278745 WP_001285607.1 NZ_CP123240:c4434154-4433786 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1M0VTI9

Antitoxin

Source ID Structure
AlphaFold DB A0A1M0JLU8

References