Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3754812..3755430 | Replicon | chromosome |
Accession | NZ_CP123240 | ||
Organism | Escherichia coli strain YZLc1-3 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | N4725_RS18200 | Protein ID | WP_001291435.1 |
Coordinates | 3755212..3755430 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | N4725_RS18195 | Protein ID | WP_000344800.1 |
Coordinates | 3754812..3755186 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4725_RS18185 (3749901) | 3749901..3751094 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
N4725_RS18190 (3751117) | 3751117..3754266 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
N4725_RS18195 (3754812) | 3754812..3755186 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
N4725_RS18200 (3755212) | 3755212..3755430 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
N4725_RS18205 (3755602) | 3755602..3756153 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
N4725_RS18210 (3756269) | 3756269..3756739 | + | 471 | WP_000136192.1 | YlaC family protein | - |
N4725_RS18215 (3756903) | 3756903..3758453 | + | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
N4725_RS18220 (3758495) | 3758495..3758848 | - | 354 | WP_001550741.1 | DUF1428 family protein | - |
N4725_RS18230 (3759227) | 3759227..3759538 | + | 312 | WP_000409911.1 | MGMT family protein | - |
N4725_RS18235 (3759569) | 3759569..3760141 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T278741 WP_001291435.1 NZ_CP123240:3755212-3755430 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT278741 WP_000344800.1 NZ_CP123240:3754812-3755186 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |