Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3297179..3297884 | Replicon | chromosome |
Accession | NZ_CP123240 | ||
Organism | Escherichia coli strain YZLc1-3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | N4725_RS16055 | Protein ID | WP_000539521.1 |
Coordinates | 3297179..3297565 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N4725_RS16060 | Protein ID | WP_001280945.1 |
Coordinates | 3297555..3297884 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4725_RS16035 (3293183) | 3293183..3293809 | + | 627 | WP_001595548.1 | glutathione S-transferase GstB | - |
N4725_RS16040 (3293806) | 3293806..3294921 | - | 1116 | WP_106475077.1 | aldose sugar dehydrogenase YliI | - |
N4725_RS16045 (3295032) | 3295032..3295415 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
N4725_RS16050 (3295628) | 3295628..3296953 | + | 1326 | WP_000049378.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
N4725_RS16055 (3297179) | 3297179..3297565 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N4725_RS16060 (3297555) | 3297555..3297884 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
N4725_RS16065 (3297954) | 3297954..3299282 | - | 1329 | WP_000086872.1 | GGDEF domain-containing protein | - |
N4725_RS16070 (3299290) | 3299290..3301368 | - | 2079 | WP_106475076.1 | EAL domain-containing protein | - |
N4725_RS16080 (3302130) | 3302130..3302414 | - | 285 | Protein_3151 | CHASE9 sensor domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T278740 WP_000539521.1 NZ_CP123240:3297179-3297565 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|