Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2711282..2711920 | Replicon | chromosome |
| Accession | NZ_CP123240 | ||
| Organism | Escherichia coli strain YZLc1-3 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
| Locus tag | N4725_RS13240 | Protein ID | WP_000813795.1 |
| Coordinates | 2711744..2711920 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N4725_RS13235 | Protein ID | WP_076797675.1 |
| Coordinates | 2711282..2711698 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4725_RS13215 (2706434) | 2706434..2707375 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| N4725_RS13220 (2707376) | 2707376..2708389 | - | 1014 | WP_001551095.1 | ABC transporter ATP-binding protein | - |
| N4725_RS13225 (2708407) | 2708407..2709552 | - | 1146 | WP_001551094.1 | ABC transporter substrate-binding protein | - |
| N4725_RS13230 (2709797) | 2709797..2711203 | - | 1407 | WP_001551093.1 | PLP-dependent aminotransferase family protein | - |
| N4725_RS13235 (2711282) | 2711282..2711698 | - | 417 | WP_076797675.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| N4725_RS13240 (2711744) | 2711744..2711920 | - | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| N4725_RS13245 (2712142) | 2712142..2712372 | + | 231 | WP_023910283.1 | YncJ family protein | - |
| N4725_RS13250 (2712464) | 2712464..2714425 | - | 1962 | WP_001551090.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| N4725_RS13255 (2714498) | 2714498..2715034 | - | 537 | WP_001551089.1 | DNA-binding transcriptional regulator SutR | - |
| N4725_RS13260 (2715126) | 2715126..2716298 | + | 1173 | WP_001551088.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T278738 WP_000813795.1 NZ_CP123240:c2711920-2711744 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15220.55 Da Isoelectric Point: 4.7386
>AT278738 WP_076797675.1 NZ_CP123240:c2711698-2711282 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|