Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1023632..1024286 | Replicon | chromosome |
| Accession | NZ_CP123240 | ||
| Organism | Escherichia coli strain YZLc1-3 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | N4725_RS05035 | Protein ID | WP_000244781.1 |
| Coordinates | 1023879..1024286 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | N4725_RS05030 | Protein ID | WP_000354046.1 |
| Coordinates | 1023632..1023898 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4725_RS05010 (1019720) | 1019720..1021153 | - | 1434 | WP_001389468.1 | 6-phospho-beta-glucosidase BglA | - |
| N4725_RS05015 (1021198) | 1021198..1021509 | + | 312 | WP_001598596.1 | N(4)-acetylcytidine aminohydrolase | - |
| N4725_RS05020 (1021673) | 1021673..1022332 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
| N4725_RS05025 (1022409) | 1022409..1023389 | - | 981 | WP_001562036.1 | tRNA-modifying protein YgfZ | - |
| N4725_RS05030 (1023632) | 1023632..1023898 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| N4725_RS05035 (1023879) | 1023879..1024286 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| N4725_RS05040 (1024326) | 1024326..1024847 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| N4725_RS05045 (1024959) | 1024959..1025855 | + | 897 | WP_000806652.1 | site-specific tyrosine recombinase XerD | - |
| N4725_RS05050 (1025880) | 1025880..1026590 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N4725_RS05055 (1026596) | 1026596..1028329 | + | 1734 | WP_001598594.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T278729 WP_000244781.1 NZ_CP123240:1023879-1024286 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|