Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 65249..65874 | Replicon | plasmid pMB7355_1 |
Accession | NZ_CP123238 | ||
Organism | Escherichia coli strain 4588 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QET42_RS23685 | Protein ID | WP_000911313.1 |
Coordinates | 65476..65874 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | QET42_RS23680 | Protein ID | WP_000450520.1 |
Coordinates | 65249..65476 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QET42_RS23680 (65249) | 65249..65476 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QET42_RS23685 (65476) | 65476..65874 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QET42_RS23690 (65883) | 65883..68036 | - | 2154 | WP_000009324.1 | type IV conjugative transfer system coupling protein TraD | - |
QET42_RS23695 (68289) | 68289..69020 | - | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
QET42_RS23700 (69052) | 69052..69549 | - | 498 | WP_000605857.1 | entry exclusion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-55 / ant(3'')-Ia / sul3 / lnu(F) / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..122596 | 122596 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T278725 WP_000911313.1 NZ_CP123238:65476-65874 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|