Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 21104..21747 | Replicon | plasmid pMB7355_1 |
Accession | NZ_CP123238 | ||
Organism | Escherichia coli strain 4588 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | QET42_RS23425 | Protein ID | WP_001044768.1 |
Coordinates | 21331..21747 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | QET42_RS23420 | Protein ID | WP_001261287.1 |
Coordinates | 21104..21334 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QET42_RS23400 (16264) | 16264..17352 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
QET42_RS23405 (17354) | 17354..19579 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
QET42_RS23410 (19629) | 19629..20528 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
QET42_RS23415 (20518) | 20518..20808 | - | 291 | WP_000111771.1 | hypothetical protein | - |
QET42_RS23420 (21104) | 21104..21334 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QET42_RS23425 (21331) | 21331..21747 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
QET42_RS23430 (21909) | 21909..24047 | - | 2139 | WP_000350638.1 | AAA family ATPase | - |
QET42_RS23435 (24401) | 24401..24658 | + | 258 | WP_000343085.1 | hypothetical protein | - |
QET42_RS23440 (24658) | 24658..25248 | + | 591 | WP_000194575.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-55 / ant(3'')-Ia / sul3 / lnu(F) / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..122596 | 122596 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T278720 WP_001044768.1 NZ_CP123238:21331-21747 [Escherichia coli]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |