Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3508833..3509451 | Replicon | chromosome |
Accession | NZ_CP123237 | ||
Organism | Escherichia coli strain 4588 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QET42_RS17355 | Protein ID | WP_001291435.1 |
Coordinates | 3509233..3509451 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QET42_RS17350 | Protein ID | WP_000344800.1 |
Coordinates | 3508833..3509207 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QET42_RS17340 (3503922) | 3503922..3505115 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QET42_RS17345 (3505138) | 3505138..3508287 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
QET42_RS17350 (3508833) | 3508833..3509207 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QET42_RS17355 (3509233) | 3509233..3509451 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QET42_RS17360 (3509623) | 3509623..3510174 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
QET42_RS17365 (3510290) | 3510290..3510760 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QET42_RS17370 (3510924) | 3510924..3512474 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QET42_RS17375 (3512516) | 3512516..3512869 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QET42_RS17385 (3513248) | 3513248..3513559 | + | 312 | WP_000409911.1 | MGMT family protein | - |
QET42_RS17390 (3513590) | 3513590..3514162 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T278715 WP_001291435.1 NZ_CP123237:3509233-3509451 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT278715 WP_000344800.1 NZ_CP123237:3508833-3509207 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |