Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2467861..2468499 | Replicon | chromosome |
Accession | NZ_CP123237 | ||
Organism | Escherichia coli strain 4588 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | QET42_RS12215 | Protein ID | WP_001447010.1 |
Coordinates | 2468323..2468499 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | QET42_RS12210 | Protein ID | WP_001270286.1 |
Coordinates | 2467861..2468277 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QET42_RS12190 (2463013) | 2463013..2463954 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
QET42_RS12195 (2463955) | 2463955..2464968 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
QET42_RS12200 (2464986) | 2464986..2466131 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
QET42_RS12205 (2466376) | 2466376..2467782 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
QET42_RS12210 (2467861) | 2467861..2468277 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
QET42_RS12215 (2468323) | 2468323..2468499 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
QET42_RS12220 (2468721) | 2468721..2468951 | + | 231 | WP_000494244.1 | YncJ family protein | - |
QET42_RS12225 (2469043) | 2469043..2471004 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
QET42_RS12230 (2471077) | 2471077..2471613 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
QET42_RS12235 (2471705) | 2471705..2472880 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T278714 WP_001447010.1 NZ_CP123237:c2468499-2468323 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT278714 WP_001270286.1 NZ_CP123237:c2468277-2467861 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|