Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1843370..1844205 | Replicon | chromosome |
| Accession | NZ_CP123237 | ||
| Organism | Escherichia coli strain 4588 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QET42_RS09030 | Protein ID | WP_042046912.1 |
| Coordinates | 1843370..1843747 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | QET42_RS09035 | Protein ID | WP_135145692.1 |
| Coordinates | 1843837..1844205 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QET42_RS08995 (1838890) | 1838890..1839363 | + | 474 | WP_001105407.1 | DNA gyrase inhibitor SbmC | - |
| QET42_RS09000 (1839561) | 1839561..1840619 | + | 1059 | WP_001200895.1 | FUSC family protein | - |
| QET42_RS09005 (1840791) | 1840791..1841120 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| QET42_RS09010 (1841221) | 1841221..1841586 | - | 366 | WP_001280455.1 | EutP/PduV family microcompartment system protein | - |
| QET42_RS09015 (1841857) | 1841857..1842228 | - | 372 | WP_001295631.1 | IS110 family transposase | - |
| QET42_RS09020 (1843044) | 1843044..1843124 | - | 81 | Protein_1764 | hypothetical protein | - |
| QET42_RS09025 (1843224) | 1843224..1843373 | - | 150 | Protein_1765 | DUF5983 family protein | - |
| QET42_RS09030 (1843370) | 1843370..1843747 | - | 378 | WP_042046912.1 | TA system toxin CbtA family protein | Toxin |
| QET42_RS09035 (1843837) | 1843837..1844205 | - | 369 | WP_135145692.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QET42_RS09040 (1844368) | 1844368..1844589 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QET42_RS09045 (1844652) | 1844652..1845128 | - | 477 | WP_001186774.1 | RadC family protein | - |
| QET42_RS09050 (1845144) | 1845144..1845617 | - | 474 | WP_000855059.1 | antirestriction protein | - |
| QET42_RS09055 (1845959) | 1845959..1846777 | - | 819 | WP_087523595.1 | DUF932 domain-containing protein | - |
| QET42_RS09060 (1846895) | 1846895..1847090 | - | 196 | Protein_1772 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14020.96 Da Isoelectric Point: 7.8276
>T278707 WP_042046912.1 NZ_CP123237:c1843747-1843370 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13545.30 Da Isoelectric Point: 6.4764
>AT278707 WP_135145692.1 NZ_CP123237:c1844205-1843837 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPHHQHTVTLYAKGLTCEADTLGSCGYAYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPHHQHTVTLYAKGLTCEADTLGSCGYAYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|