Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 958467..959050 | Replicon | chromosome |
Accession | NZ_CP123237 | ||
Organism | Escherichia coli strain 4588 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QET42_RS04680 | Protein ID | WP_049253269.1 |
Coordinates | 958715..959050 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A1V2T5M9 |
Locus tag | QET42_RS04675 | Protein ID | WP_000581941.1 |
Coordinates | 958467..958715 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QET42_RS04665 (954806) | 954806..956107 | + | 1302 | WP_023281448.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QET42_RS04670 (956155) | 956155..958389 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
QET42_RS04675 (958467) | 958467..958715 | + | 249 | WP_000581941.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QET42_RS04680 (958715) | 958715..959050 | + | 336 | WP_049253269.1 | endoribonuclease MazF | Toxin |
QET42_RS04685 (959121) | 959121..959912 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QET42_RS04690 (960140) | 960140..961777 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
QET42_RS04695 (961865) | 961865..963163 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12197.18 Da Isoelectric Point: 8.7218
>T278705 WP_049253269.1 NZ_CP123237:958715-959050 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQARHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQARHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|