Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 821009..821663 | Replicon | chromosome |
Accession | NZ_CP123237 | ||
Organism | Escherichia coli strain 4588 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | QET42_RS04055 | Protein ID | WP_000244777.1 |
Coordinates | 821256..821663 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QET42_RS04050 | Protein ID | WP_000354046.1 |
Coordinates | 821009..821275 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QET42_RS04025 (816178) | 816178..816921 | + | 744 | WP_000951962.1 | SDR family oxidoreductase | - |
QET42_RS04030 (816978) | 816978..818411 | - | 1434 | WP_001338826.1 | 6-phospho-beta-glucosidase BglA | - |
QET42_RS04035 (818456) | 818456..818767 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
QET42_RS04040 (818931) | 818931..819590 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QET42_RS04045 (819786) | 819786..820766 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
QET42_RS04050 (821009) | 821009..821275 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QET42_RS04055 (821256) | 821256..821663 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
QET42_RS04060 (821703) | 821703..822224 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QET42_RS04065 (822336) | 822336..823232 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QET42_RS04070 (823257) | 823257..823967 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QET42_RS04075 (823973) | 823973..825706 | + | 1734 | WP_000813201.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T278704 WP_000244777.1 NZ_CP123237:821256-821663 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |