Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 76079..76722 Replicon plasmid pMB11100_2
Accession NZ_CP123233
Organism Escherichia coli strain 5132

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag QET41_RS25255 Protein ID WP_001034046.1
Coordinates 76079..76495 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag QET41_RS25260 Protein ID WP_001261278.1
Coordinates 76492..76722 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QET41_RS25240 (QET41_25240) 71216..71632 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
QET41_RS25245 (QET41_25245) 71629..71859 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
QET41_RS25250 (QET41_25250) 72240..76034 + 3795 WP_001144732.1 hypothetical protein -
QET41_RS25255 (QET41_25255) 76079..76495 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
QET41_RS25260 (QET41_25260) 76492..76722 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QET41_RS25265 (QET41_25265) 76987..77487 + 501 WP_001773886.1 HEPN family nuclease -
QET41_RS25270 (QET41_25270) 77500..78273 + 774 WP_000905949.1 hypothetical protein -
QET41_RS25275 (QET41_25275) 78440..79573 + 1134 WP_001542067.1 DUF3800 domain-containing protein -
QET41_RS25280 (QET41_25280) 79607..80119 - 513 WP_000151784.1 hypothetical protein -
QET41_RS25285 (QET41_25285) 80686..80904 + 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
QET41_RS25290 (QET41_25290) 80906..81211 + 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mph(A) senB 1..87114 87114


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T278699 WP_001034046.1 NZ_CP123233:c76495-76079 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT278699 WP_001261278.1 NZ_CP123233:c76722-76492 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References