Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4422316..4423148 | Replicon | chromosome |
| Accession | NZ_CP123231 | ||
| Organism | Escherichia coli strain 5132 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | QET41_RS21640 | Protein ID | WP_000854753.1 |
| Coordinates | 4422774..4423148 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NQ68 |
| Locus tag | QET41_RS21635 | Protein ID | WP_001540478.1 |
| Coordinates | 4422316..4422684 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QET41_RS21600 (4418149) | 4418149..4418829 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
| QET41_RS21605 (4418977) | 4418977..4419654 | + | 678 | WP_001097301.1 | hypothetical protein | - |
| QET41_RS21610 (4419660) | 4419660..4419893 | + | 234 | WP_001278283.1 | DUF905 family protein | - |
| QET41_RS21615 (4419983) | 4419983..4420801 | + | 819 | WP_001773857.1 | DUF932 domain-containing protein | - |
| QET41_RS21620 (4420892) | 4420892..4421377 | + | 486 | WP_000214398.1 | antirestriction protein | - |
| QET41_RS21625 (4421393) | 4421393..4421869 | + | 477 | WP_001186786.1 | RadC family protein | - |
| QET41_RS21630 (4421932) | 4421932..4422153 | + | 222 | WP_000692311.1 | DUF987 domain-containing protein | - |
| QET41_RS21635 (4422316) | 4422316..4422684 | + | 369 | WP_001540478.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QET41_RS21640 (4422774) | 4422774..4423148 | + | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| QET41_RS21645 (4423145) | 4423145..4423633 | + | 489 | WP_000777545.1 | DUF5983 family protein | - |
| QET41_RS21650 (4423645) | 4423645..4423842 | + | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| QET41_RS21655 (4423939) | 4423939..4424508 | + | 570 | WP_001560692.1 | DUF4942 domain-containing protein | - |
| QET41_RS21660 (4425257) | 4425257..4426795 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4378473..4434608 | 56135 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T278691 WP_000854753.1 NZ_CP123231:4422774-4423148 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13652.53 Da Isoelectric Point: 7.8398
>AT278691 WP_001540478.1 NZ_CP123231:4422316-4422684 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NQ68 |