Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4009973..4010523 Replicon chromosome
Accession NZ_CP123231
Organism Escherichia coli strain 5132

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QET41_RS19550 Protein ID WP_001160966.1
Coordinates 4009973..4010287 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag QET41_RS19555 Protein ID WP_000125568.1
Coordinates 4010290..4010523 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QET41_RS19525 (4005648) 4005648..4006934 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QET41_RS19530 (4006934) 4006934..4007923 + 990 WP_000241225.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QET41_RS19535 (4007920) 4007920..4008741 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QET41_RS19540 (4008744) 4008744..4009121 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QET41_RS19545 (4009128) 4009128..4009976 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QET41_RS19550 (4009973) 4009973..4010287 - 315 WP_001160966.1 CcdB family protein Toxin
QET41_RS19555 (4010290) 4010290..4010523 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QET41_RS19560 (4010609) 4010609..4011088 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QET41_RS19565 (4011280) 4011280..4013142 - 1863 WP_000377109.1 glutathione-regulated potassium-efflux system protein KefC -
QET41_RS19570 (4013135) 4013135..4013665 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QET41_RS19575 (4013773) 4013773..4015104 - 1332 WP_001183207.1 MFS transporter -
QET41_RS19580 (4015163) 4015163..4015450 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T278684 WP_001160966.1 NZ_CP123231:c4010287-4009973 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT278684 WP_000125568.1 NZ_CP123231:c4010523-4010290 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References