Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3535266..3535884 | Replicon | chromosome |
Accession | NZ_CP123231 | ||
Organism | Escherichia coli strain 5132 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QET41_RS17305 | Protein ID | WP_001291435.1 |
Coordinates | 3535666..3535884 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QET41_RS17300 | Protein ID | WP_000344800.1 |
Coordinates | 3535266..3535640 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QET41_RS17290 (3530355) | 3530355..3531548 | + | 1194 | WP_001538394.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QET41_RS17295 (3531571) | 3531571..3534720 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
QET41_RS17300 (3535266) | 3535266..3535640 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QET41_RS17305 (3535666) | 3535666..3535884 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QET41_RS17310 (3536057) | 3536057..3536608 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
QET41_RS17315 (3536724) | 3536724..3537194 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QET41_RS17320 (3537358) | 3537358..3538908 | + | 1551 | WP_001538392.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QET41_RS17325 (3538950) | 3538950..3539303 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
QET41_RS17335 (3539682) | 3539682..3539993 | + | 312 | WP_000409908.1 | MGMT family protein | - |
QET41_RS17340 (3540024) | 3540024..3540596 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T278682 WP_001291435.1 NZ_CP123231:3535666-3535884 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT278682 WP_000344800.1 NZ_CP123231:3535266-3535640 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |