Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1130265..1130848 | Replicon | chromosome |
Accession | NZ_CP123231 | ||
Organism | Escherichia coli strain 5132 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1PVD8 |
Locus tag | QET41_RS05400 | Protein ID | WP_000254749.1 |
Coordinates | 1130513..1130848 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | QET41_RS05395 | Protein ID | WP_000581937.1 |
Coordinates | 1130265..1130513 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QET41_RS05385 (1126604) | 1126604..1127905 | + | 1302 | WP_000046817.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
QET41_RS05390 (1127953) | 1127953..1130187 | + | 2235 | WP_000226797.1 | GTP diphosphokinase | - |
QET41_RS05395 (1130265) | 1130265..1130513 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
QET41_RS05400 (1130513) | 1130513..1130848 | + | 336 | WP_000254749.1 | endoribonuclease MazF | Toxin |
QET41_RS05405 (1130920) | 1130920..1131711 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
QET41_RS05410 (1131939) | 1131939..1133576 | + | 1638 | WP_001774030.1 | CTP synthase (glutamine hydrolyzing) | - |
QET41_RS05415 (1133664) | 1133664..1134962 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12137.06 Da Isoelectric Point: 8.7218
>T278674 WP_000254749.1 NZ_CP123231:1130513-1130848 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|