Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 974267..974921 | Replicon | chromosome |
Accession | NZ_CP123231 | ||
Organism | Escherichia coli strain 5132 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | QET41_RS04770 | Protein ID | WP_000244781.1 |
Coordinates | 974514..974921 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | QET41_RS04765 | Protein ID | WP_000354046.1 |
Coordinates | 974267..974533 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QET41_RS04745 (970355) | 970355..971788 | - | 1434 | WP_001339296.1 | 6-phospho-beta-glucosidase BglA | - |
QET41_RS04750 (971833) | 971833..972144 | + | 312 | WP_001182959.1 | N(4)-acetylcytidine aminohydrolase | - |
QET41_RS04755 (972308) | 972308..972967 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
QET41_RS04760 (973044) | 973044..974024 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
QET41_RS04765 (974267) | 974267..974533 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
QET41_RS04770 (974514) | 974514..974921 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
QET41_RS04775 (974961) | 974961..975482 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QET41_RS04780 (975594) | 975594..976490 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QET41_RS04785 (976515) | 976515..977225 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QET41_RS04790 (977231) | 977231..978964 | + | 1734 | WP_000813189.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T278673 WP_000244781.1 NZ_CP123231:974514-974921 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PAM6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |