Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PfiT-PfiA/ParE-Phd
Location 100156..100767 Replicon plasmid pCOR2250
Accession NZ_CP123227
Organism Pseudomonas amygdali pv. aesculi strain 2250

Toxin (Protein)


Gene name PfiT Uniprot ID A0A0P9HD56
Locus tag QEP70_RS30120 Protein ID WP_005734903.1
Coordinates 100417..100767 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name PfiA Uniprot ID A0A0P9H624
Locus tag QEP70_RS30115 Protein ID WP_005734904.1
Coordinates 100156..100404 (+) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEP70_RS30095 96228..96932 - 705 WP_060409903.1 GNAT family N-acetyltransferase -
QEP70_RS30100 97134..98356 + 1223 WP_157062301.1 IS3-like element IS51 family transposase -
QEP70_RS30105 98473..98787 + 315 WP_005734906.1 hypothetical protein -
QEP70_RS30110 98863..99825 - 963 WP_005734905.1 tyrosine-type recombinase/integrase -
QEP70_RS30115 100156..100404 + 249 WP_005734904.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
QEP70_RS30120 100417..100767 + 351 WP_005734903.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QEP70_RS30125 100873..101277 - 405 WP_005734902.1 DUF4279 domain-containing protein -
QEP70_RS30130 101286..101378 - 93 WP_280124527.1 polymorphic toxin type 33 domain-containing protein -
QEP70_RS30135 101477..102454 + 978 WP_032701292.1 IS5 family transposase -
QEP70_RS30140 102922..103902 - 981 WP_243580935.1 IS5-like element ISPsy2 family transposase -
QEP70_RS30145 104174..105151 + 978 WP_032701292.1 IS5 family transposase -
QEP70_RS30150 105278..105553 - 276 WP_236732658.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..116443 116443
- inside IScluster/Tn - - 85073..112748 27675


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13014.96 Da        Isoelectric Point: 4.2805

>T278667 WP_005734903.1 NZ_CP123227:100417-100767 [Pseudomonas amygdali pv. aesculi]
MNTFALRFTEVAQQSIEDQVEHLAITQGFSLAAQRINTLIDVIQDKLLSTPLGYPVSPQLSELGILHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPM

Download         Length: 351 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 9338.68 Da        Isoelectric Point: 9.8450

>AT278667 WP_005734904.1 NZ_CP123227:100156-100404 [Pseudomonas amygdali pv. aesculi]
MRVETISYLKRNAADLPLDEPLVVTQNGVPAYVVESYADRKRRDESIALVKLLAISSRDYSQGKHCSTDELKARLSRRFA
QK

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0P9HD56

Antitoxin

Source ID Structure
AlphaFold DB A0A0P9H624

References