Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 11587..12034 Replicon plasmid pCOR2250
Accession NZ_CP123227
Organism Pseudomonas amygdali pv. aesculi strain 2250

Toxin (Protein)


Gene name relE Uniprot ID E7PTW5
Locus tag QEP70_RS29655 Protein ID WP_004662083.1
Coordinates 11762..12034 (+) Length 91 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID E7PTW6
Locus tag QEP70_RS29650 Protein ID WP_003381808.1
Coordinates 11587..11772 (+) Length 62 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEP70_RS29630 7014..7310 + 297 WP_004666829.1 coronamic acid biosynthesis protein CmaL -
QEP70_RS29635 7336..8392 - 1057 Protein_7 IS630 family transposase -
QEP70_RS29640 8843..9820 - 978 WP_032701292.1 IS5 family transposase -
QEP70_RS29645 10111..11340 + 1230 WP_081087350.1 IS91 family transposase -
QEP70_RS29650 11587..11772 + 186 WP_003381808.1 hypothetical protein Antitoxin
QEP70_RS29655 11762..12034 + 273 WP_004662083.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QEP70_RS29660 12138..12851 + 714 WP_060409922.1 YecA family protein -
QEP70_RS29665 13097..13324 + 228 WP_057413040.1 hypothetical protein -
QEP70_RS29670 13490..14712 + 1223 WP_243580924.1 IS3-like element IS51 family transposase -
QEP70_RS29675 15053..15202 + 150 Protein_15 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..116443 116443
- inside IScluster/Tn - - 1568..41229 39661


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10185.64 Da        Isoelectric Point: 5.0749

>T278665 WP_004662083.1 NZ_CP123227:11762-12034 [Pseudomonas amygdali pv. aesculi]
VLVEWLPQALEALEEIAGYLAERNPYAAEQMQATLEATVEALPLHPYIHRPGRVPGTREAVVHPNYLVVYRVGTERISIV
DVLHARQEYP

Download         Length: 273 bp

Antitoxin


Download         Length: 62 a.a.        Molecular weight: 7296.25 Da        Isoelectric Point: 8.7721

>AT278665 WP_003381808.1 NZ_CP123227:11587-11772 [Pseudomonas amygdali pv. aesculi]
MSIQLDPRVSEFETQEQADNYDRWFRLRIERSLADPRPPVPHDEAMARVRAMIEAKRRRAS

Download         Length: 186 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N8QF55

Antitoxin

Source ID Structure
AlphaFold DB A0A2V0QZQ1

References