Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapB(antitoxin) |
| Location | 9719..10293 | Replicon | plasmid pPae2250Z |
| Accession | NZ_CP123226 | ||
| Organism | Pseudomonas amygdali pv. aesculi strain 2250 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q48BC5 |
| Locus tag | QEP70_RS29220 | Protein ID | WP_003344395.1 |
| Coordinates | 9916..10293 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QEP70_RS29215 | Protein ID | WP_060406773.1 |
| Coordinates | 9719..9919 (+) | Length | 67 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEP70_RS29195 | 5512..5721 | - | 210 | Protein_5 | hypothetical protein | - |
| QEP70_RS29200 | 5792..6220 | - | 429 | WP_060409866.1 | GntR family transcriptional regulator | - |
| QEP70_RS29205 | 6266..8554 | - | 2289 | WP_280124526.1 | F-type conjugative transfer protein TrbC | - |
| QEP70_RS29210 | 8541..9626 | - | 1086 | WP_060409950.1 | thioredoxin fold domain-containing protein | - |
| QEP70_RS29215 | 9719..9919 | + | 201 | WP_060406773.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QEP70_RS29220 | 9916..10293 | + | 378 | WP_003344395.1 | PIN domain-containing protein | Toxin |
| QEP70_RS29225 | 10283..11485 | - | 1203 | WP_060409842.1 | hypothetical protein | - |
| QEP70_RS29230 | 11577..12227 | - | 651 | WP_060409909.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QEP70_RS29235 | 12224..12469 | - | 246 | WP_003344389.1 | hypothetical protein | - |
| QEP70_RS29240 | 12572..14716 | - | 2145 | WP_060409910.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..73292 | 73292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13633.73 Da Isoelectric Point: 6.4723
>T278664 WP_003344395.1 NZ_CP123226:9916-10293 [Pseudomonas amygdali pv. aesculi]
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRSNTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRSNTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|