Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 2509067..2509586 Replicon chromosome
Accession NZ_CP123221
Organism Pseudomonas amygdali pv. aesculi strain 2250

Toxin (Protein)


Gene name relE Uniprot ID Q48Q48
Locus tag QEP70_RS11765 Protein ID WP_002551445.1
Coordinates 2509067..2509357 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID S6UWW5
Locus tag QEP70_RS11770 Protein ID WP_002551444.1
Coordinates 2509347..2509586 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEP70_RS11740 2504737..2505291 - 555 WP_010205022.1 histidine phosphatase family protein -
QEP70_RS11745 2505347..2506606 + 1260 WP_005730411.1 IS256-like element ISPsy17 family transposase -
QEP70_RS11750 2506838..2507179 - 342 WP_005734122.1 DUF5713 family protein -
QEP70_RS11755 2507369..2507791 + 423 WP_005734119.1 DUF1493 family protein -
QEP70_RS11760 2508097..2508834 + 738 WP_005734118.1 hypothetical protein -
QEP70_RS11765 2509067..2509357 - 291 WP_002551445.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QEP70_RS11770 2509347..2509586 - 240 WP_002551444.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QEP70_RS11775 2509750..2510223 - 474 WP_010214544.1 GNAT family N-acetyltransferase -
QEP70_RS11780 2510325..2510873 - 549 WP_010214542.1 GNAT family N-acetyltransferase -
QEP70_RS11785 2511033..2511527 + 495 WP_004667254.1 hypothetical protein -
QEP70_RS11790 2511561..2512835 - 1275 WP_004667253.1 OprD family porin -
QEP70_RS11795 2513050..2513283 - 234 WP_002551440.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2443854..2520268 76414


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-64)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11316.19 Da        Isoelectric Point: 10.2579

>T278660 WP_002551445.1 NZ_CP123221:c2509357-2509067 [Pseudomonas amygdali pv. aesculi]
MTYNLEFDARALKEWHKLGDTVRQQLKKKLATILVAPRVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
REREEVYRKATDRLGR

Download         Length: 291 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8955.34 Da        Isoelectric Point: 4.6017

>AT278660 WP_002551444.1 NZ_CP123221:c2509586-2509347 [Pseudomonas amygdali pv. aesculi]
MASINVRIDDDLKARAYLELEKLGVTPSELLRQTLQYVAERGQLPFKTVLMTEEDEALLATVRERLAAPQRVKVSLDDL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2G4DBS4

Antitoxin

Source ID Structure
AlphaFold DB A0A0K8M1G9

References