Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 4520..5067 | Replicon | plasmid pPae2203X |
Accession | NZ_CP123220 | ||
Organism | Pseudomonas amygdali pv. aesculi strain 2203 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q48B48 |
Locus tag | QEP68_RS29955 | Protein ID | WP_003319696.1 |
Coordinates | 4741..5067 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A7V8M172 |
Locus tag | QEP68_RS29950 | Protein ID | WP_003319697.1 |
Coordinates | 4520..4744 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEP68_RS29910 | 1..1302 | + | 1302 | WP_060406807.1 | replication initiation protein | - |
QEP68_RS29915 | 1462..1878 | + | 417 | WP_010214328.1 | hypothetical protein | - |
QEP68_RS29920 | 1914..2144 | + | 231 | WP_010214330.1 | hypothetical protein | - |
QEP68_RS29925 | 2261..2773 | + | 513 | WP_236732330.1 | hypothetical protein | - |
QEP68_RS29930 | 2841..3446 | - | 606 | WP_010214332.1 | hypothetical protein | - |
QEP68_RS29935 | 3446..3619 | - | 174 | WP_005759896.1 | hypothetical protein | - |
QEP68_RS29940 | 3802..3993 | - | 192 | WP_060406806.1 | hypothetical protein | - |
QEP68_RS29945 | 4043..4282 | - | 240 | Protein_7 | recombinase family protein | - |
QEP68_RS29950 | 4520..4744 | + | 225 | WP_003319697.1 | antitoxin MazE family protein | Antitoxin |
QEP68_RS29955 | 4741..5067 | + | 327 | WP_003319696.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QEP68_RS29960 | 5450..5853 | - | 404 | Protein_10 | transposase | - |
QEP68_RS29965 | 6011..8380 | + | 2370 | WP_010213983.1 | hypothetical protein | - |
QEP68_RS29970 | 8382..8588 | + | 207 | WP_031599323.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..49730 | 49730 | |
- | flank | IS/Tn | - | - | 5530..5802 | 272 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11660.71 Da Isoelectric Point: 8.0546
>T278659 WP_003319696.1 NZ_CP123220:4741-5067 [Pseudomonas amygdali pv. aesculi]
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7V8S2J7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7V8M172 |