Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pasABC/RelE-HTH |
| Location | 52792..53269 | Replicon | plasmid pPae2203P |
| Accession | NZ_CP123218 | ||
| Organism | Pseudomonas amygdali pv. aesculi strain 2203 | ||
Toxin (Protein)
| Gene name | pasB | Uniprot ID | A0A0P9I0A0 |
| Locus tag | QEP68_RS29465 | Protein ID | WP_005730593.1 |
| Coordinates | 52792..53058 (-) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | A0A3R8W5Z2 |
| Locus tag | QEP68_RS29470 | Protein ID | WP_005730594.1 |
| Coordinates | 53042..53269 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEP68_RS29440 | 48041..48319 | - | 279 | Protein_50 | type II toxin-antitoxin system YafQ family toxin | - |
| QEP68_RS29445 | 48306..48569 | - | 264 | WP_005730323.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| QEP68_RS29450 | 48774..49220 | + | 447 | WP_232289920.1 | type III effector | - |
| QEP68_RS29455 | 49543..50773 | + | 1231 | WP_280124519.1 | IS91 family transposase | - |
| QEP68_RS29460 | 51493..52527 | - | 1035 | WP_280124518.1 | IS110-like element ISPsy16 family transposase | - |
| QEP68_RS29465 | 52792..53058 | - | 267 | WP_005730593.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QEP68_RS29470 | 53042..53269 | - | 228 | WP_005730594.1 | hypothetical protein | Antitoxin |
| QEP68_RS29475 | 53532..54455 | - | 924 | WP_060406699.1 | recombinase family protein | - |
| QEP68_RS29480 | 54662..54901 | + | 240 | WP_010216588.1 | ribbon-helix-helix domain-containing protein | - |
| QEP68_RS29485 | 54901..55320 | + | 420 | WP_005734741.1 | putative toxin-antitoxin system toxin component, PIN family | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..70379 | 70379 | |
| - | inside | IScluster/Tn | - | - | 3390..59900 | 56510 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10201.73 Da Isoelectric Point: 10.2748
>T278658 WP_005730593.1 NZ_CP123218:c53058-52792 [Pseudomonas amygdali pv. aesculi]
MAWTIDYTDTAKTQLRKLDKQSAKRILDFMDERVSSRDDPRTTGKALTGPLGGLWRYRVGDFRVICEIQDGALRILVVQL
GNRREVYR
MAWTIDYTDTAKTQLRKLDKQSAKRILDFMDERVSSRDDPRTTGKALTGPLGGLWRYRVGDFRVICEIQDGALRILVVQL
GNRREVYR
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P9I0A0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R8W5Z2 |