Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PemK-MazE |
| Location | 22349..22896 | Replicon | plasmid pPae2203P |
| Accession | NZ_CP123218 | ||
| Organism | Pseudomonas amygdali pv. aesculi strain 2203 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q48B48 |
| Locus tag | QEP68_RS29315 | Protein ID | WP_003319696.1 |
| Coordinates | 22349..22675 (-) | Length | 109 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A7V8M172 |
| Locus tag | QEP68_RS29320 | Protein ID | WP_003319697.1 |
| Coordinates | 22672..22896 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEP68_RS29300 | 18077..18451 | + | 375 | WP_234785910.1 | hypothetical protein | - |
| QEP68_RS29305 | 19321..20532 | - | 1212 | WP_234785911.1 | IS91 family transposase | - |
| QEP68_RS29310 | 21202..22137 | + | 936 | WP_280125002.1 | protein-tyrosine phosphatase family protein | - |
| QEP68_RS29315 | 22349..22675 | - | 327 | WP_003319696.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QEP68_RS29320 | 22672..22896 | - | 225 | WP_003319697.1 | antitoxin MazE family protein | Antitoxin |
| QEP68_RS29325 | 23499..24197 | + | 699 | WP_005734862.1 | ParA family protein | - |
| QEP68_RS29330 | 24190..24513 | + | 324 | WP_005734861.1 | hypothetical protein | - |
| QEP68_RS29335 | 24864..26093 | - | 1230 | WP_081087346.1 | IS91 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..70379 | 70379 | |
| - | inside | IScluster/Tn | - | - | 3390..59900 | 56510 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11660.71 Da Isoelectric Point: 8.0546
>T278657 WP_003319696.1 NZ_CP123218:c22675-22349 [Pseudomonas amygdali pv. aesculi]
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V8S2J7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7V8M172 |