Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapB(antitoxin) |
| Location | 68110..68684 | Replicon | plasmid pPae2203Z |
| Accession | NZ_CP123217 | ||
| Organism | Pseudomonas amygdali pv. aesculi strain 2203 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q48BC5 |
| Locus tag | QEP68_RS29160 | Protein ID | WP_003344395.1 |
| Coordinates | 68110..68487 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QEP68_RS29165 | Protein ID | WP_060406773.1 |
| Coordinates | 68484..68684 (-) | Length | 67 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEP68_RS29140 | 63687..65831 | + | 2145 | WP_060409910.1 | DotA/TraY family protein | - |
| QEP68_RS29145 | 65934..66179 | + | 246 | WP_003344389.1 | hypothetical protein | - |
| QEP68_RS29150 | 66176..66826 | + | 651 | WP_060409909.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QEP68_RS29155 | 66918..68120 | + | 1203 | WP_060409842.1 | hypothetical protein | - |
| QEP68_RS29160 | 68110..68487 | - | 378 | WP_003344395.1 | PIN domain-containing protein | Toxin |
| QEP68_RS29165 | 68484..68684 | - | 201 | WP_060406773.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QEP68_RS29170 | 68777..69862 | + | 1086 | WP_060409950.1 | thioredoxin fold domain-containing protein | - |
| QEP68_RS29175 | 69849..72137 | + | 2289 | WP_243580938.1 | F-type conjugative transfer protein TrbC | - |
| QEP68_RS29180 | 72183..72611 | + | 429 | WP_060409866.1 | GntR family transcriptional regulator | - |
| QEP68_RS29185 | 72682..72891 | + | 210 | Protein_85 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..73292 | 73292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13633.73 Da Isoelectric Point: 6.4723
>T278656 WP_003344395.1 NZ_CP123217:c68487-68110 [Pseudomonas amygdali pv. aesculi]
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRSNTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRSNTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|