Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 118871..119318 Replicon plasmid pCOR2203
Accession NZ_CP123216
Organism Pseudomonas amygdali pv. aesculi strain 2203

Toxin (Protein)


Gene name relE Uniprot ID E7PTW5
Locus tag QEP68_RS28460 Protein ID WP_004662083.1
Coordinates 118871..119143 (-) Length 91 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A3M4C5H0
Locus tag QEP68_RS28465 Protein ID WP_005730485.1
Coordinates 119133..119318 (-) Length 62 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEP68_RS28440 115119..115823 + 705 WP_060409903.1 GNAT family N-acetyltransferase -
QEP68_RS28445 116428..117240 - 813 WP_005730366.1 DUF3037 domain-containing protein -
QEP68_RS28450 117237..117980 - 744 WP_004667958.1 hypothetical protein -
QEP68_RS28455 118054..118767 - 714 WP_044322701.1 YecA family protein -
QEP68_RS28460 118871..119143 - 273 WP_004662083.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QEP68_RS28465 119133..119318 - 186 WP_005730485.1 hypothetical protein Antitoxin
QEP68_RS28470 119369..119647 - 279 WP_024661522.1 hypothetical protein -
QEP68_RS28475 119905..120885 - 981 WP_057403839.1 IS5-like element ISPsy2 family transposase -
QEP68_RS28480 120928..121101 - 174 Protein_140 helix-turn-helix domain-containing protein -
QEP68_RS28485 121142..121345 - 204 Protein_141 Tn3 family transposase -
QEP68_RS28490 121498..122188 + 691 Protein_142 Tn3 family transposase -
QEP68_RS28495 122299..123333 + 1035 WP_243580921.1 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..181117 181117
- inside IScluster/Tn - - 100517..126978 26461


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10185.64 Da        Isoelectric Point: 5.0749

>T278655 WP_004662083.1 NZ_CP123216:c119143-118871 [Pseudomonas amygdali pv. aesculi]
VLVEWLPQALEALEEIAGYLAERNPYAAEQMQATLEATVEALPLHPYIHRPGRVPGTREAVVHPNYLVVYRVGTERISIV
DVLHARQEYP

Download         Length: 273 bp

Antitoxin


Download         Length: 62 a.a.        Molecular weight: 7292.18 Da        Isoelectric Point: 7.2040

>AT278655 WP_005730485.1 NZ_CP123216:c119318-119133 [Pseudomonas amygdali pv. aesculi]
MSIQLDPRVSEFETQEQADNYDRWFRQRIEHSLADPRPPVPHDEAMARVRAMIEAKRRRAS

Download         Length: 186 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N8QF55

Antitoxin

Source ID Structure
AlphaFold DB A0A3M4C5H0

References