Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE-Phd |
Location | 111284..111895 | Replicon | plasmid pCOR2203 |
Accession | NZ_CP123216 | ||
Organism | Pseudomonas amygdali pv. aesculi strain 2203 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A0P9HD56 |
Locus tag | QEP68_RS28415 | Protein ID | WP_005734903.1 |
Coordinates | 111284..111634 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0P9H624 |
Locus tag | QEP68_RS28420 | Protein ID | WP_005734904.1 |
Coordinates | 111647..111895 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEP68_RS28380 | 106613..107422 | + | 810 | WP_243580873.1 | IS21-like element ISPsy4 family helper ATPase IstB | - |
QEP68_RS28385 | 107465..107572 | + | 108 | Protein_121 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QEP68_RS28390 | 107712..107987 | + | 276 | WP_236732658.1 | hypothetical protein | - |
QEP68_RS28395 | 108114..109091 | - | 978 | WP_032701292.1 | IS5 family transposase | - |
QEP68_RS28400 | 109363..110343 | + | 981 | WP_243580935.1 | IS5-like element ISPsy2 family transposase | - |
QEP68_RS28405 | 110538..110765 | + | 228 | WP_057412924.1 | polymorphic toxin type 33 domain-containing protein | - |
QEP68_RS28410 | 110774..111178 | + | 405 | WP_005734902.1 | DUF4279 domain-containing protein | - |
QEP68_RS28415 | 111284..111634 | - | 351 | WP_005734903.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QEP68_RS28420 | 111647..111895 | - | 249 | WP_005734904.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
QEP68_RS28425 | 112226..113188 | + | 963 | WP_005734905.1 | tyrosine-type recombinase/integrase | - |
QEP68_RS28430 | 113264..113578 | - | 315 | WP_005734906.1 | hypothetical protein | - |
QEP68_RS28440 | 115119..115823 | + | 705 | WP_060409903.1 | GNAT family N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..181117 | 181117 | |
- | inside | IScluster/Tn | - | - | 100517..126978 | 26461 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13014.96 Da Isoelectric Point: 4.2805
>T278654 WP_005734903.1 NZ_CP123216:c111634-111284 [Pseudomonas amygdali pv. aesculi]
MNTFALRFTEVAQQSIEDQVEHLAITQGFSLAAQRINTLIDVIQDKLLSTPLGYPVSPQLSELGILHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPM
MNTFALRFTEVAQQSIEDQVEHLAITQGFSLAAQRINTLIDVIQDKLLSTPLGYPVSPQLSELGILHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPM
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P9HD56 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P9H624 |