Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/-
Location 26728..27206 Replicon plasmid pCOR2203
Accession NZ_CP123216
Organism Pseudomonas amygdali pv. aesculi strain 2203

Toxin (Protein)


Gene name relE Uniprot ID A0A2S4ICR4
Locus tag QEP68_RS27900 Protein ID WP_005730619.1
Coordinates 26728..27021 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A2S4HLF9
Locus tag QEP68_RS27905 Protein ID WP_003348562.1
Coordinates 27021..27206 (-) Length 62 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEP68_RS27865 22440..23380 - 941 Protein_17 IS3 family transposase -
QEP68_RS27870 23393..23626 - 234 WP_060409948.1 hypothetical protein -
QEP68_RS27875 23898..24467 + 570 WP_234785935.1 recombinase family protein -
QEP68_RS27880 24702..24809 + 108 Protein_20 resolvase -
QEP68_RS27885 24904..25176 + 273 WP_044322702.1 hypothetical protein -
QEP68_RS27890 25262..26065 + 804 WP_005734736.1 MobQ family relaxase -
QEP68_RS27895 26127..26588 - 462 WP_005734737.1 hypothetical protein -
QEP68_RS27900 26728..27021 - 294 WP_005730619.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QEP68_RS27905 27021..27206 - 186 WP_003348562.1 hypothetical protein Antitoxin
QEP68_RS27915 28713..28985 - 273 WP_060406870.1 hypothetical protein -
QEP68_RS27920 29079..29714 - 636 WP_060406871.1 recombinase family protein -
QEP68_RS27925 30215..30865 + 651 WP_003344252.1 ParA family protein -
QEP68_RS27930 30946..31236 + 291 WP_010217231.1 hypothetical protein -
QEP68_RS27935 31310..31453 + 144 WP_155511877.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..181117 181117
- inside IScluster/Tn - - 22380..28550 6170


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11192.94 Da        Isoelectric Point: 6.2150

>T278652 WP_005730619.1 NZ_CP123216:c27021-26728 [Pseudomonas amygdali pv. aesculi]
MLPIFWLESADNDLAAIIEYIGLRDIAAAERLWQRLRSIVLPLSEHPYLYAISDRVPGMREIVAHPNYLVFYRVTSTRIE
VVNVVHARQEYPQTGLA

Download         Length: 294 bp

Antitoxin


Download         Length: 62 a.a.        Molecular weight: 7134.04 Da        Isoelectric Point: 6.4675

>AT278652 WP_003348562.1 NZ_CP123216:c27206-27021 [Pseudomonas amygdali pv. aesculi]
MIDRSPIVSEFETEELEANYTAWLRAKVEASLADSRPAIPHDEVERRMAERLARLRHRRAS

Download         Length: 186 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2S4ICR4

Antitoxin

Source ID Structure
AlphaFold DB A0A2S4HLF9

References