Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 5770233..5770752 Replicon chromosome
Accession NZ_CP123215
Organism Pseudomonas amygdali pv. aesculi strain 2203

Toxin (Protein)


Gene name relE Uniprot ID Q48Q48
Locus tag QEP68_RS26225 Protein ID WP_002551445.1
Coordinates 5770233..5770523 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID S6UWW5
Locus tag QEP68_RS26230 Protein ID WP_002551444.1
Coordinates 5770513..5770752 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEP68_RS26200 5765903..5766457 - 555 WP_010205022.1 histidine phosphatase family protein -
QEP68_RS26205 5766513..5767772 + 1260 WP_005730411.1 IS256-like element ISPsy17 family transposase -
QEP68_RS26210 5768004..5768345 - 342 WP_005734122.1 DUF5713 family protein -
QEP68_RS26215 5768535..5768957 + 423 WP_005734119.1 DUF1493 family protein -
QEP68_RS26220 5769263..5770000 + 738 WP_005734118.1 hypothetical protein -
QEP68_RS26225 5770233..5770523 - 291 WP_002551445.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QEP68_RS26230 5770513..5770752 - 240 WP_002551444.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QEP68_RS26235 5770916..5771389 - 474 WP_010214544.1 GNAT family N-acetyltransferase -
QEP68_RS26240 5771491..5772039 - 549 WP_010214542.1 GNAT family N-acetyltransferase -
QEP68_RS26245 5772199..5772693 + 495 WP_004667254.1 hypothetical protein -
QEP68_RS26250 5772727..5774001 - 1275 WP_004667253.1 OprD family porin -
QEP68_RS26255 5774216..5774449 - 234 WP_002551440.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-64)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11316.19 Da        Isoelectric Point: 10.2579

>T278651 WP_002551445.1 NZ_CP123215:c5770523-5770233 [Pseudomonas amygdali pv. aesculi]
MTYNLEFDARALKEWHKLGDTVRQQLKKKLATILVAPRVEANRLHALPDCYKIKLRSSGYRLVYQVIDQEVVVFVVAVDK
REREEVYRKATDRLGR

Download         Length: 291 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8955.34 Da        Isoelectric Point: 4.6017

>AT278651 WP_002551444.1 NZ_CP123215:c5770752-5770513 [Pseudomonas amygdali pv. aesculi]
MASINVRIDDDLKARAYLELEKLGVTPSELLRQTLQYVAERGQLPFKTVLMTEEDEALLATVRERLAAPQRVKVSLDDL

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2G4DBS4

Antitoxin

Source ID Structure
AlphaFold DB A0A0K8M1G9

References