Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PfiT-PfiA/ParE-Phd |
| Location | 98867..99478 | Replicon | plasmid pCOR1804 |
| Accession | NZ_CP123214 | ||
| Organism | Pseudomonas amygdali pv. aesculi strain 1804 | ||
Toxin (Protein)
| Gene name | PfiT | Uniprot ID | A0A0P9HD56 |
| Locus tag | QEP69_RS29930 | Protein ID | WP_005734903.1 |
| Coordinates | 99128..99478 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | PfiA | Uniprot ID | A0A0P9H624 |
| Locus tag | QEP69_RS29925 | Protein ID | WP_005734904.1 |
| Coordinates | 98867..99115 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEP69_RS29905 | 94939..95643 | - | 705 | WP_060409903.1 | GNAT family N-acetyltransferase | - |
| QEP69_RS29910 | 95845..97067 | + | 1223 | WP_157062301.1 | IS3-like element IS51 family transposase | - |
| QEP69_RS29915 | 97184..97498 | + | 315 | WP_005734906.1 | hypothetical protein | - |
| QEP69_RS29920 | 97574..98536 | - | 963 | WP_005734905.1 | tyrosine-type recombinase/integrase | - |
| QEP69_RS29925 | 98867..99115 | + | 249 | WP_005734904.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| QEP69_RS29930 | 99128..99478 | + | 351 | WP_005734903.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QEP69_RS29935 | 99584..99988 | - | 405 | WP_005734902.1 | DUF4279 domain-containing protein | - |
| QEP69_RS29940 | 99997..100224 | - | 228 | WP_057412924.1 | polymorphic toxin type 33 domain-containing protein | - |
| QEP69_RS29945 | 100419..101399 | - | 981 | WP_243580935.1 | IS5-like element ISPsy2 family transposase | - |
| QEP69_RS29950 | 101671..102648 | + | 978 | WP_032701292.1 | IS5 family transposase | - |
| QEP69_RS29955 | 102775..103050 | - | 276 | WP_236732658.1 | hypothetical protein | - |
| QEP69_RS29960 | 103190..103297 | - | 108 | Protein_109 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QEP69_RS29965 | 103340..104149 | - | 810 | WP_280124492.1 | IS21-like element ISPsy4 family helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..114960 | 114960 | |
| - | inside | IScluster/Tn | - | - | 83784..110245 | 26461 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13014.96 Da Isoelectric Point: 4.2805
>T278650 WP_005734903.1 NZ_CP123214:99128-99478 [Pseudomonas amygdali pv. aesculi]
MNTFALRFTEVAQQSIEDQVEHLAITQGFSLAAQRINTLIDVIQDKLLSTPLGYPVSPQLSELGILHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPM
MNTFALRFTEVAQQSIEDQVEHLAITQGFSLAAQRINTLIDVIQDKLLSTPLGYPVSPQLSELGILHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPM
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P9HD56 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P9H624 |