Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 10567..11014 | Replicon | plasmid pCOR1804 |
| Accession | NZ_CP123214 | ||
| Organism | Pseudomonas amygdali pv. aesculi strain 1804 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | E7PTW5 |
| Locus tag | QEP69_RS29470 | Protein ID | WP_004662083.1 |
| Coordinates | 10742..11014 (+) | Length | 91 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | E7PTW6 |
| Locus tag | QEP69_RS29465 | Protein ID | WP_003381808.1 |
| Coordinates | 10567..10752 (+) | Length | 62 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QEP69_RS29445 | 5994..6290 | + | 297 | WP_004666829.1 | coronamic acid biosynthesis protein CmaL | - |
| QEP69_RS29450 | 6316..7372 | - | 1057 | Protein_7 | IS630 family transposase | - |
| QEP69_RS29455 | 7823..8800 | - | 978 | WP_032701292.1 | IS5 family transposase | - |
| QEP69_RS29460 | 9091..10320 | + | 1230 | WP_280124528.1 | IS91 family transposase | - |
| QEP69_RS29465 | 10567..10752 | + | 186 | WP_003381808.1 | hypothetical protein | Antitoxin |
| QEP69_RS29470 | 10742..11014 | + | 273 | WP_004662083.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QEP69_RS29475 | 11118..11831 | + | 714 | WP_060409922.1 | YecA family protein | - |
| QEP69_RS29480 | 12077..12304 | + | 228 | WP_057413040.1 | hypothetical protein | - |
| QEP69_RS29485 | 12470..13692 | + | 1223 | WP_280124751.1 | IS3-like element IS51 family transposase | - |
| QEP69_RS29490 | 14033..14182 | + | 150 | Protein_15 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..114960 | 114960 | |
| - | inside | IScluster/Tn | - | - | 548..30708 | 30160 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10185.64 Da Isoelectric Point: 5.0749
>T278648 WP_004662083.1 NZ_CP123214:10742-11014 [Pseudomonas amygdali pv. aesculi]
VLVEWLPQALEALEEIAGYLAERNPYAAEQMQATLEATVEALPLHPYIHRPGRVPGTREAVVHPNYLVVYRVGTERISIV
DVLHARQEYP
VLVEWLPQALEALEEIAGYLAERNPYAAEQMQATLEATVEALPLHPYIHRPGRVPGTREAVVHPNYLVVYRVGTERISIV
DVLHARQEYP
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0N8QF55 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2V0QZQ1 |