Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapB(antitoxin) |
Location | 99610..100184 | Replicon | plasmid pPae1804ZI |
Accession | NZ_CP123213 | ||
Organism | Pseudomonas amygdali pv. aesculi strain 1804 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q48BC5 |
Locus tag | QEP69_RS29245 | Protein ID | WP_003344395.1 |
Coordinates | 99610..99987 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | QEP69_RS29250 | Protein ID | WP_060406773.1 |
Coordinates | 99984..100184 (-) | Length | 67 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEP69_RS29225 | 95187..97331 | + | 2145 | WP_060409910.1 | DotA/TraY family protein | - |
QEP69_RS29230 | 97434..97679 | + | 246 | WP_003344389.1 | hypothetical protein | - |
QEP69_RS29235 | 97676..98326 | + | 651 | WP_060409909.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
QEP69_RS29240 | 98418..99620 | + | 1203 | WP_060409842.1 | hypothetical protein | - |
QEP69_RS29245 | 99610..99987 | - | 378 | WP_003344395.1 | PIN domain-containing protein | Toxin |
QEP69_RS29250 | 99984..100184 | - | 201 | WP_060406773.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
QEP69_RS29255 | 100277..101362 | + | 1086 | WP_060409950.1 | thioredoxin fold domain-containing protein | - |
QEP69_RS29260 | 101349..103637 | + | 2289 | WP_280124526.1 | F-type conjugative transfer protein TrbC | - |
QEP69_RS29265 | 103683..104111 | + | 429 | WP_060409866.1 | GntR family transcriptional regulator | - |
QEP69_RS29270 | 104182..104391 | + | 210 | Protein_128 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..136841 | 136841 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13633.73 Da Isoelectric Point: 6.4723
>T278647 WP_003344395.1 NZ_CP123213:c99987-99610 [Pseudomonas amygdali pv. aesculi]
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRSNTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRSNTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVDMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|