Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/- |
Location | 1329..1807 | Replicon | plasmid pPae1804ZI |
Accession | NZ_CP123213 | ||
Organism | Pseudomonas amygdali pv. aesculi strain 1804 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2S4ICR4 |
Locus tag | QEP69_RS28640 | Protein ID | WP_005730619.1 |
Coordinates | 1329..1622 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2S4HLF9 |
Locus tag | QEP69_RS28645 | Protein ID | WP_003348562.1 |
Coordinates | 1622..1807 (-) | Length | 62 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEP69_RS28630 | 1..666 | + | 666 | WP_010206144.1 | MobA/MobL family protein | - |
QEP69_RS28635 | 728..1189 | - | 462 | WP_005734737.1 | hypothetical protein | - |
QEP69_RS28640 | 1329..1622 | - | 294 | WP_005730619.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QEP69_RS28645 | 1622..1807 | - | 186 | WP_003348562.1 | hypothetical protein | Antitoxin |
QEP69_RS28655 | 3314..3586 | - | 273 | WP_060406870.1 | hypothetical protein | - |
QEP69_RS28660 | 3680..4315 | - | 636 | WP_060406871.1 | recombinase family protein | - |
QEP69_RS28665 | 4816..5466 | + | 651 | WP_003344252.1 | ParA family protein | - |
QEP69_RS28670 | 5547..5837 | + | 291 | WP_010217231.1 | hypothetical protein | - |
QEP69_RS28675 | 5911..6054 | + | 144 | WP_155511877.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..136841 | 136841 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11192.94 Da Isoelectric Point: 6.2150
>T278646 WP_005730619.1 NZ_CP123213:c1622-1329 [Pseudomonas amygdali pv. aesculi]
MLPIFWLESADNDLAAIIEYIGLRDIAAAERLWQRLRSIVLPLSEHPYLYAISDRVPGMREIVAHPNYLVFYRVTSTRIE
VVNVVHARQEYPQTGLA
MLPIFWLESADNDLAAIIEYIGLRDIAAAERLWQRLRSIVLPLSEHPYLYAISDRVPGMREIVAHPNYLVFYRVTSTRIE
VVNVVHARQEYPQTGLA
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S4ICR4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2S4HLF9 |