Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 24086..24563 | Replicon | plasmid pPae1804P |
Accession | NZ_CP123211 | ||
Organism | Pseudomonas amygdali pv. aesculi strain 1804 |
Toxin (Protein)
Gene name | pasB | Uniprot ID | A0A0P9I0A0 |
Locus tag | QEP69_RS28065 | Protein ID | WP_005730593.1 |
Coordinates | 24297..24563 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | A0A3R8W5Z2 |
Locus tag | QEP69_RS28060 | Protein ID | WP_005730594.1 |
Coordinates | 24086..24313 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEP69_RS28045 | 22035..22454 | - | 420 | WP_005734741.1 | putative toxin-antitoxin system toxin component, PIN family | - |
QEP69_RS28050 | 22454..22693 | - | 240 | WP_010216588.1 | ribbon-helix-helix domain-containing protein | - |
QEP69_RS28055 | 22900..23823 | + | 924 | WP_060406699.1 | recombinase family protein | - |
QEP69_RS28060 | 24086..24313 | + | 228 | WP_005730594.1 | hypothetical protein | Antitoxin |
QEP69_RS28065 | 24297..24563 | + | 267 | WP_005730593.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QEP69_RS28070 | 24828..25862 | + | 1035 | WP_280124518.1 | IS110-like element ISPsy16 family transposase | - |
QEP69_RS28080 | 28135..28581 | - | 447 | WP_232289920.1 | type III effector | - |
QEP69_RS28085 | 28786..29049 | + | 264 | WP_005730323.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
QEP69_RS28090 | 29036..29314 | + | 279 | Protein_30 | type II toxin-antitoxin system YafQ family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..70047 | 70047 | |
- | inside | IScluster/Tn | - | - | 17454..69929 | 52475 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10201.73 Da Isoelectric Point: 10.2748
>T278644 WP_005730593.1 NZ_CP123211:24297-24563 [Pseudomonas amygdali pv. aesculi]
MAWTIDYTDTAKTQLRKLDKQSAKRILDFMDERVSSRDDPRTTGKALTGPLGGLWRYRVGDFRVICEIQDGALRILVVQL
GNRREVYR
MAWTIDYTDTAKTQLRKLDKQSAKRILDFMDERVSSRDDPRTTGKALTGPLGGLWRYRVGDFRVICEIQDGALRILVVQL
GNRREVYR
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P9I0A0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8W5Z2 |