Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 24086..24563 Replicon plasmid pPae1804P
Accession NZ_CP123211
Organism Pseudomonas amygdali pv. aesculi strain 1804

Toxin (Protein)


Gene name pasB Uniprot ID A0A0P9I0A0
Locus tag QEP69_RS28065 Protein ID WP_005730593.1
Coordinates 24297..24563 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID A0A3R8W5Z2
Locus tag QEP69_RS28060 Protein ID WP_005730594.1
Coordinates 24086..24313 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEP69_RS28045 22035..22454 - 420 WP_005734741.1 putative toxin-antitoxin system toxin component, PIN family -
QEP69_RS28050 22454..22693 - 240 WP_010216588.1 ribbon-helix-helix domain-containing protein -
QEP69_RS28055 22900..23823 + 924 WP_060406699.1 recombinase family protein -
QEP69_RS28060 24086..24313 + 228 WP_005730594.1 hypothetical protein Antitoxin
QEP69_RS28065 24297..24563 + 267 WP_005730593.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QEP69_RS28070 24828..25862 + 1035 WP_280124518.1 IS110-like element ISPsy16 family transposase -
QEP69_RS28080 28135..28581 - 447 WP_232289920.1 type III effector -
QEP69_RS28085 28786..29049 + 264 WP_005730323.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
QEP69_RS28090 29036..29314 + 279 Protein_30 type II toxin-antitoxin system YafQ family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..70047 70047
- inside IScluster/Tn - - 17454..69929 52475


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10201.73 Da        Isoelectric Point: 10.2748

>T278644 WP_005730593.1 NZ_CP123211:24297-24563 [Pseudomonas amygdali pv. aesculi]
MAWTIDYTDTAKTQLRKLDKQSAKRILDFMDERVSSRDDPRTTGKALTGPLGGLWRYRVGDFRVICEIQDGALRILVVQL
GNRREVYR

Download         Length: 267 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8540.57 Da        Isoelectric Point: 4.6135

>AT278644 WP_005730594.1 NZ_CP123211:24086-24313 [Pseudomonas amygdali pv. aesculi]
MATSIRLAPETEQRLDFLATSTGRTKAYYLREIIDHGLTDLEDYYLAAEVLERVRKNTEVVHSAADVRKDLGLDD

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0P9I0A0

Antitoxin

Source ID Structure
AlphaFold DB A0A3R8W5Z2

References