Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 42197..42744 | Replicon | plasmid pPae1804X |
Accession | NZ_CP123210 | ||
Organism | Pseudomonas amygdali pv. aesculi strain 1804 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q48B48 |
Locus tag | QEP69_RS27910 | Protein ID | WP_003319696.1 |
Coordinates | 42418..42744 (+) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A7V8M172 |
Locus tag | QEP69_RS27905 | Protein ID | WP_003319697.1 |
Coordinates | 42197..42421 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEP69_RS27865 | 37678..38979 | + | 1302 | WP_060406807.1 | replication initiation protein | - |
QEP69_RS27870 | 39139..39555 | + | 417 | WP_010214328.1 | hypothetical protein | - |
QEP69_RS27875 | 39591..39821 | + | 231 | WP_010214330.1 | hypothetical protein | - |
QEP69_RS27880 | 39866..40450 | + | 585 | WP_280124748.1 | hypothetical protein | - |
QEP69_RS27885 | 40518..41123 | - | 606 | WP_010214332.1 | hypothetical protein | - |
QEP69_RS27890 | 41123..41296 | - | 174 | WP_005759896.1 | hypothetical protein | - |
QEP69_RS27895 | 41479..41670 | - | 192 | WP_060406806.1 | hypothetical protein | - |
QEP69_RS27900 | 41720..41959 | - | 240 | Protein_46 | recombinase family protein | - |
QEP69_RS27905 | 42197..42421 | + | 225 | WP_003319697.1 | antitoxin MazE family protein | Antitoxin |
QEP69_RS27910 | 42418..42744 | + | 327 | WP_003319696.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QEP69_RS27915 | 43127..43530 | - | 404 | Protein_49 | transposase | - |
QEP69_RS27920 | 43688..46057 | + | 2370 | WP_010213983.1 | hypothetical protein | - |
QEP69_RS27925 | 46059..46265 | + | 207 | WP_031599323.1 | hypothetical protein | - |
QEP69_RS27930 | 46426..46599 | - | 174 | WP_010213980.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..49732 | 49732 | |
- | flank | IS/Tn | - | - | 43207..43479 | 272 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11660.71 Da Isoelectric Point: 8.0546
>T278643 WP_003319696.1 NZ_CP123210:42418-42744 [Pseudomonas amygdali pv. aesculi]
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7V8S2J7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7V8M172 |