Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 53990..54467 | Replicon | plasmid pPae6617P |
Accession | NZ_CP123207 | ||
Organism | Pseudomonas amygdali pv. aesculi strain 6617 |
Toxin (Protein)
Gene name | pasB | Uniprot ID | A0A0P9I0A0 |
Locus tag | QEP71_RS29225 | Protein ID | WP_005730593.1 |
Coordinates | 53990..54256 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | A0A3R8W5Z2 |
Locus tag | QEP71_RS29230 | Protein ID | WP_005730594.1 |
Coordinates | 54240..54467 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEP71_RS29200 | 49239..49517 | - | 279 | Protein_50 | type II toxin-antitoxin system YafQ family toxin | - |
QEP71_RS29205 | 49504..49767 | - | 264 | WP_005730323.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
QEP71_RS29210 | 49972..50418 | + | 447 | WP_232289920.1 | type III effector | - |
QEP71_RS29215 | 50741..51971 | + | 1231 | WP_280124519.1 | IS91 family transposase | - |
QEP71_RS29220 | 52691..53725 | - | 1035 | WP_280124518.1 | IS110-like element ISPsy16 family transposase | - |
QEP71_RS29225 | 53990..54256 | - | 267 | WP_005730593.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QEP71_RS29230 | 54240..54467 | - | 228 | WP_005730594.1 | hypothetical protein | Antitoxin |
QEP71_RS29235 | 54730..55653 | - | 924 | WP_060406699.1 | recombinase family protein | - |
QEP71_RS29240 | 55860..56099 | + | 240 | WP_010216588.1 | ribbon-helix-helix domain-containing protein | - |
QEP71_RS29245 | 56099..56518 | + | 420 | WP_005734741.1 | putative toxin-antitoxin system toxin component, PIN family | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..71577 | 71577 | |
- | inside | IScluster/Tn | - | - | 3390..61098 | 57708 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10201.73 Da Isoelectric Point: 10.2748
>T278641 WP_005730593.1 NZ_CP123207:c54256-53990 [Pseudomonas amygdali pv. aesculi]
MAWTIDYTDTAKTQLRKLDKQSAKRILDFMDERVSSRDDPRTTGKALTGPLGGLWRYRVGDFRVICEIQDGALRILVVQL
GNRREVYR
MAWTIDYTDTAKTQLRKLDKQSAKRILDFMDERVSSRDDPRTTGKALTGPLGGLWRYRVGDFRVICEIQDGALRILVVQL
GNRREVYR
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P9I0A0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3R8W5Z2 |