Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 23547..24094 | Replicon | plasmid pPae6617P |
Accession | NZ_CP123207 | ||
Organism | Pseudomonas amygdali pv. aesculi strain 6617 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q48B48 |
Locus tag | QEP71_RS29075 | Protein ID | WP_003319696.1 |
Coordinates | 23547..23873 (-) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A7V8M172 |
Locus tag | QEP71_RS29080 | Protein ID | WP_003319697.1 |
Coordinates | 23870..24094 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEP71_RS29060 | 19275..19649 | + | 375 | WP_234785910.1 | hypothetical protein | - |
QEP71_RS29065 | 20519..21730 | - | 1212 | WP_234785911.1 | IS91 family transposase | - |
QEP71_RS29070 | 21935..23335 | + | 1401 | WP_010217001.1 | protein-tyrosine phosphatase family protein | - |
QEP71_RS29075 | 23547..23873 | - | 327 | WP_003319696.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QEP71_RS29080 | 23870..24094 | - | 225 | WP_003319697.1 | antitoxin MazE family protein | Antitoxin |
QEP71_RS29085 | 24697..25395 | + | 699 | WP_005734862.1 | ParA family protein | - |
QEP71_RS29090 | 25388..25711 | + | 324 | WP_005734861.1 | hypothetical protein | - |
QEP71_RS29095 | 26062..27291 | - | 1230 | WP_243580959.1 | IS91 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..71577 | 71577 | |
- | inside | IScluster/Tn | - | - | 3390..61098 | 57708 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11660.71 Da Isoelectric Point: 8.0546
>T278640 WP_003319696.1 NZ_CP123207:c23873-23547 [Pseudomonas amygdali pv. aesculi]
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN
MMRGDLVTVAMQGDFGKPRPALVIQANQFSEHTSVTVLPVTSTLVAAPLLRITVQPTAENGLQKPSQVMLDKTMTLKREK
IGPTFGHIGVDSMVEVERCLAVFLGIAN
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7V8S2J7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7V8M172 |