Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 92733..93180 Replicon plasmid pCOR6617
Accession NZ_CP123205
Organism Pseudomonas amygdali pv. aesculi strain 6617

Toxin (Protein)


Gene name relE Uniprot ID E7PTW5
Locus tag QEP71_RS28400 Protein ID WP_004662083.1
Coordinates 92908..93180 (+) Length 91 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A3M4C5H0
Locus tag QEP71_RS28395 Protein ID WP_005730485.1
Coordinates 92733..92918 (+) Length 62 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QEP71_RS28365 88718..89752 - 1035 WP_243580921.1 IS110 family transposase -
QEP71_RS28370 89863..90553 - 691 Protein_89 Tn3 family transposase -
QEP71_RS28375 90706..90909 + 204 Protein_90 Tn3 family transposase -
QEP71_RS28380 90950..91123 + 174 Protein_91 helix-turn-helix domain-containing protein -
QEP71_RS28385 91166..92146 + 981 WP_057403839.1 IS5-like element ISPsy2 family transposase -
QEP71_RS28390 92404..92682 + 279 WP_024661522.1 hypothetical protein -
QEP71_RS28395 92733..92918 + 186 WP_005730485.1 hypothetical protein Antitoxin
QEP71_RS28400 92908..93180 + 273 WP_004662083.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QEP71_RS28405 93284..93997 + 714 WP_044322701.1 YecA family protein -
QEP71_RS28410 94071..94814 + 744 WP_004667958.1 hypothetical protein -
QEP71_RS28415 94811..95623 + 813 WP_005730366.1 DUF3037 domain-containing protein -
QEP71_RS28420 96228..96932 - 705 WP_060409903.1 GNAT family N-acetyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..115332 115332
- inside IScluster/Tn - - 85073..111637 26564


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-89)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 91 a.a.        Molecular weight: 10185.64 Da        Isoelectric Point: 5.0749

>T278637 WP_004662083.1 NZ_CP123205:92908-93180 [Pseudomonas amygdali pv. aesculi]
VLVEWLPQALEALEEIAGYLAERNPYAAEQMQATLEATVEALPLHPYIHRPGRVPGTREAVVHPNYLVVYRVGTERISIV
DVLHARQEYP

Download         Length: 273 bp

Antitoxin


Download         Length: 62 a.a.        Molecular weight: 7292.18 Da        Isoelectric Point: 7.2040

>AT278637 WP_005730485.1 NZ_CP123205:92733-92918 [Pseudomonas amygdali pv. aesculi]
MSIQLDPRVSEFETQEQADNYDRWFRQRIEHSLADPRPPVPHDEAMARVRAMIEAKRRRAS

Download         Length: 186 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N8QF55

Antitoxin

Source ID Structure
AlphaFold DB A0A3M4C5H0

References