Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 11587..12034 | Replicon | plasmid pCOR6617 |
Accession | NZ_CP123205 | ||
Organism | Pseudomonas amygdali pv. aesculi strain 6617 |
Toxin (Protein)
Gene name | relE | Uniprot ID | E7PTW5 |
Locus tag | QEP71_RS27980 | Protein ID | WP_004662083.1 |
Coordinates | 11762..12034 (+) | Length | 91 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | E7PTW6 |
Locus tag | QEP71_RS27975 | Protein ID | WP_003381808.1 |
Coordinates | 11587..11772 (+) | Length | 62 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEP71_RS27955 | 7014..7310 | + | 297 | WP_004666829.1 | coronamic acid biosynthesis protein CmaL | - |
QEP71_RS27960 | 7336..8392 | - | 1057 | Protein_7 | IS630 family transposase | - |
QEP71_RS27965 | 8843..9820 | - | 978 | WP_032701292.1 | IS5 family transposase | - |
QEP71_RS27970 | 10111..11340 | + | 1230 | WP_081087350.1 | IS91 family transposase | - |
QEP71_RS27975 | 11587..11772 | + | 186 | WP_003381808.1 | hypothetical protein | Antitoxin |
QEP71_RS27980 | 11762..12034 | + | 273 | WP_004662083.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QEP71_RS27985 | 12138..12851 | + | 714 | WP_060409922.1 | YecA family protein | - |
QEP71_RS27990 | 13097..13324 | + | 228 | WP_057413040.1 | hypothetical protein | - |
QEP71_RS27995 | 13490..14712 | + | 1223 | WP_243580924.1 | IS3-like element IS51 family transposase | - |
QEP71_RS28000 | 15053..15202 | + | 150 | Protein_15 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..115332 | 115332 | |
- | inside | IScluster/Tn | - | - | 1568..41229 | 39661 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10185.64 Da Isoelectric Point: 5.0749
>T278636 WP_004662083.1 NZ_CP123205:11762-12034 [Pseudomonas amygdali pv. aesculi]
VLVEWLPQALEALEEIAGYLAERNPYAAEQMQATLEATVEALPLHPYIHRPGRVPGTREAVVHPNYLVVYRVGTERISIV
DVLHARQEYP
VLVEWLPQALEALEEIAGYLAERNPYAAEQMQATLEATVEALPLHPYIHRPGRVPGTREAVVHPNYLVVYRVGTERISIV
DVLHARQEYP
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0N8QF55 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2V0QZQ1 |