Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 3391..3992 | Replicon | plasmid unnamed3 |
Accession | NZ_CP123199 | ||
Organism | Escherichia coli strain C-SRM-3 |
Toxin (Protein)
Gene name | doc | Uniprot ID | F4TND7 |
Locus tag | PAE60_RS25110 | Protein ID | WP_001216030.1 |
Coordinates | 3612..3992 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | PAE60_RS25105 | Protein ID | WP_001190712.1 |
Coordinates | 3391..3612 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAE60_RS25095 (PAE60_025095) | 375..1655 | - | 1281 | WP_260240996.1 | restriction endonuclease subunit S | - |
PAE60_RS25100 (PAE60_025100) | 1652..3208 | - | 1557 | WP_029401414.1 | type I restriction-modification system subunit M | - |
PAE60_RS25105 (PAE60_025105) | 3391..3612 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PAE60_RS25110 (PAE60_025110) | 3612..3992 | + | 381 | WP_001216030.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PAE60_RS25115 (PAE60_025115) | 3997..4176 | + | 180 | WP_000113018.1 | hypothetical protein | - |
PAE60_RS25120 (PAE60_025120) | 4204..5247 | + | 1044 | WP_000648833.1 | DUF968 domain-containing protein | - |
PAE60_RS25125 (PAE60_025125) | 5336..5788 | + | 453 | WP_032305380.1 | hypothetical protein | - |
PAE60_RS25130 (PAE60_025130) | 5875..7068 | + | 1194 | WP_000219604.1 | terminase | - |
PAE60_RS25135 (PAE60_025135) | 7068..8552 | + | 1485 | WP_000124150.1 | terminase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..96709 | 96709 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13601.29 Da Isoelectric Point: 5.1408
>T278634 WP_001216030.1 NZ_CP123199:3612-3992 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEDITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEDITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M1W8Q3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |