Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
Location | 3910198..3911242 | Replicon | chromosome |
Accession | NZ_CP123197 | ||
Organism | Escherichia coli strain C-SRM-3 |
Toxin (Protein)
Gene name | panT | Uniprot ID | A0A829CP20 |
Locus tag | PAE60_RS20245 | Protein ID | WP_000019186.1 |
Coordinates | 3910198..3910746 (-) | Length | 183 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | A0A839B6W4 |
Locus tag | PAE60_RS20250 | Protein ID | WP_000287252.1 |
Coordinates | 3910769..3911242 (-) | Length | 158 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAE60_RS20210 (3905410) | 3905410..3905961 | - | 552 | WP_000515860.1 | protein YmfL | - |
PAE60_RS20215 (3906005) | 3906005..3906205 | - | 201 | WP_000649477.1 | YdaS family helix-turn-helix protein | - |
PAE60_RS20220 (3906296) | 3906296..3906970 | + | 675 | WP_000859462.1 | LexA family transcriptional repressor | - |
PAE60_RS20225 (3907637) | 3907637..3907999 | + | 363 | WP_000135682.1 | protein YfdP | - |
PAE60_RS20230 (3908065) | 3908065..3908889 | + | 825 | WP_001753751.1 | DUF2303 family protein | - |
PAE60_RS20235 (3909076) | 3909076..3909858 | + | 783 | WP_000610754.1 | hypothetical protein | - |
PAE60_RS20240 (3909895) | 3909895..3910164 | + | 270 | WP_001093912.1 | pyocin activator PrtN family protein | - |
PAE60_RS20245 (3910198) | 3910198..3910746 | - | 549 | WP_000019186.1 | hypothetical protein | Toxin |
PAE60_RS20250 (3910769) | 3910769..3911242 | - | 474 | WP_000287252.1 | DUF4065 domain-containing protein | Antitoxin |
PAE60_RS20255 (3911547) | 3911547..3911651 | - | 105 | Protein_3734 | tRNA-dihydrouridine synthase | - |
PAE60_RS20260 (3912014) | 3912014..3912754 | - | 741 | WP_001324389.1 | DUF2713 family protein | - |
PAE60_RS20265 (3912749) | 3912749..3913030 | - | 282 | Protein_3736 | DUF2713 domain-containing protein | - |
PAE60_RS20270 (3913348) | 3913348..3913863 | + | 516 | WP_001295691.1 | zinc uptake transcriptional repressor Zur | - |
PAE60_RS20275 (3913905) | 3913905..3914114 | - | 210 | WP_001030593.1 | CsbD family protein | - |
PAE60_RS20280 (3914230) | 3914230..3915555 | - | 1326 | WP_001301116.1 | MATE family efflux transporter DinF | - |
PAE60_RS20285 (3915628) | 3915628..3916236 | - | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3885451..3916236 | 30785 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 183 a.a. Molecular weight: 20026.39 Da Isoelectric Point: 4.4481
>T278631 WP_000019186.1 NZ_CP123197:c3910746-3910198 [Escherichia coli]
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKAPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDSDKEK
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKAPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDSDKEK
Download Length: 549 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17298.80 Da Isoelectric Point: 8.4143
>AT278631 WP_000287252.1 NZ_CP123197:c3911242-3910769 [Escherichia coli]
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CP20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A839B6W4 |