Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1330743..1331574 Replicon chromosome
Accession NZ_CP123197
Organism Escherichia coli strain C-SRM-3

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag PAE60_RS07505 Protein ID WP_000854814.1
Coordinates 1330743..1331117 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag PAE60_RS07510 Protein ID WP_001285585.1
Coordinates 1331206..1331574 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PAE60_RS07465 (1326139) 1326139..1327305 + 1167 WP_000830163.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
PAE60_RS07470 (1327424) 1327424..1327897 + 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
PAE60_RS07475 (1328095) 1328095..1329153 + 1059 WP_001200905.1 FUSC family protein -
PAE60_RS07480 (1329325) 1329325..1329654 + 330 WP_000450409.1 DUF496 family protein -
PAE60_RS07485 (1329755) 1329755..1330078 - 324 WP_225343796.1 EutP/PduV family microcompartment system protein -
PAE60_RS07490 (1330057) 1330057..1330137 + 81 WP_023441679.1 hypothetical protein -
PAE60_RS07495 (1330426) 1330426..1330506 - 81 Protein_1238 hypothetical protein -
PAE60_RS07500 (1330552) 1330552..1330746 - 195 WP_000988600.1 DUF5983 family protein -
PAE60_RS07505 (1330743) 1330743..1331117 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
PAE60_RS07510 (1331206) 1331206..1331574 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
PAE60_RS07515 (1331648) 1331648..1331869 - 222 WP_000692323.1 DUF987 domain-containing protein -
PAE60_RS07520 (1331932) 1331932..1332408 - 477 WP_001186773.1 RadC family protein -
PAE60_RS07525 (1332424) 1332424..1332903 - 480 WP_000860076.1 antirestriction protein -
PAE60_RS07530 (1332985) 1332985..1333806 - 822 WP_001234530.1 DUF932 domain-containing protein -
PAE60_RS07535 (1334027) 1334027..1334437 - 411 WP_000846713.1 hypothetical protein -
PAE60_RS07540 (1334453) 1334453..1335135 - 683 Protein_1247 hypothetical protein -
PAE60_RS07545 (1335271) 1335271..1336341 - 1071 WP_000102643.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T278623 WP_000854814.1 NZ_CP123197:c1331117-1330743 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT278623 WP_001285585.1 NZ_CP123197:c1331574-1331206 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References