Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 828770..829395 | Replicon | chromosome |
Accession | NZ_CP123197 | ||
Organism | Escherichia coli strain C-SRM-3 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PAE60_RS05195 | Protein ID | WP_000911330.1 |
Coordinates | 828997..829395 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | PAE60_RS05190 | Protein ID | WP_000450524.1 |
Coordinates | 828770..828997 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAE60_RS05165 (824573) | 824573..825043 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
PAE60_RS05170 (825043) | 825043..825615 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
PAE60_RS05175 (825761) | 825761..826639 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
PAE60_RS05180 (826656) | 826656..827690 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
PAE60_RS05185 (827903) | 827903..828616 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
PAE60_RS05190 (828770) | 828770..828997 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PAE60_RS05195 (828997) | 828997..829395 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PAE60_RS05200 (829542) | 829542..830405 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
PAE60_RS05205 (830420) | 830420..832435 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
PAE60_RS05210 (832509) | 832509..833207 | + | 699 | WP_000679823.1 | esterase | - |
PAE60_RS05215 (833317) | 833317..833517 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T278621 WP_000911330.1 NZ_CP123197:828997-829395 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|