Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 73855..74377 Replicon plasmid unnamed2
Accession NZ_CP123196
Organism Escherichia coli strain C-SRM-3

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag PAE60_RS00900 Protein ID WP_000220561.1
Coordinates 74096..74377 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag PAE60_RS00895 Protein ID WP_000121743.1
Coordinates 73855..74106 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PAE60_RS00875 (69978) 69978..70331 - 354 WP_024129958.1 DNA distortion polypeptide 3 -
PAE60_RS00880 (70468) 70468..70914 - 447 WP_001074384.1 hypothetical protein -
PAE60_RS00885 (70918) 70918..71760 - 843 WP_000435064.1 replication initiation protein -
PAE60_RS00890 (71781) 71781..72620 - 840 WP_024129959.1 replication initiation protein -
PAE60_RS00895 (73855) 73855..74106 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
PAE60_RS00900 (74096) 74096..74377 + 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PAE60_RS00905 (74616) 74616..74708 - 93 Protein_92 IS6 family transposase -
PAE60_RS00910 (74874) 74874..76079 - 1206 Protein_93 IS91 family transposase -
PAE60_RS00915 (76089) 76089..76277 - 189 WP_000957857.1 hypothetical protein -
PAE60_RS00920 (76507) 76507..76611 + 105 WP_032409716.1 hypothetical protein -
PAE60_RS00925 (76740) 76740..76997 + 258 WP_000764642.1 hypothetical protein -
PAE60_RS00930 (77055) 77055..77831 - 777 WP_000015958.1 site-specific integrase -
PAE60_RS00935 (77828) 77828..78571 - 744 WP_000129823.1 hypothetical protein -
PAE60_RS00940 (78622) 78622..78972 - 351 WP_063100444.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaCTX-M-55 / blaTEM-1B / fosA3 / aph(3')-IIa / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR - 1..113069 113069


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T278611 WP_000220561.1 NZ_CP123196:74096-74377 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT278611 WP_000121743.1 NZ_CP123196:73855-74106 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References