Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE(toxin) |
| Location | 1603164..1603686 | Replicon | chromosome |
| Accession | NZ_CP123057 | ||
| Organism | Brucella intermedia strain TSBOI | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | QBQ48_RS20005 | Protein ID | WP_280135262.1 |
| Coordinates | 1603399..1603686 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | QBQ48_RS20000 | Protein ID | WP_109989459.1 |
| Coordinates | 1603164..1603409 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QBQ48_RS19965 (QBQ48_19965) | 1598248..1599270 | - | 1023 | WP_025090391.1 | ABC transporter substrate-binding protein | - |
| QBQ48_RS19970 (QBQ48_19970) | 1599555..1600529 | - | 975 | WP_280135258.1 | LysR family transcriptional regulator | - |
| QBQ48_RS19975 (QBQ48_19975) | 1600623..1601117 | + | 495 | WP_025090389.1 | DMT family transporter | - |
| QBQ48_RS19980 (QBQ48_19980) | 1601137..1601577 | + | 441 | WP_280135259.1 | VOC family protein | - |
| QBQ48_RS19985 (QBQ48_19985) | 1601747..1602397 | + | 651 | WP_280135260.1 | LysE family translocator | - |
| QBQ48_RS19990 (QBQ48_19990) | 1602342..1602578 | - | 237 | WP_280135261.1 | transposase | - |
| QBQ48_RS19995 (QBQ48_19995) | 1602631..1603011 | + | 381 | WP_280135319.1 | helix-turn-helix transcriptional regulator | - |
| QBQ48_RS20000 (QBQ48_20000) | 1603164..1603409 | + | 246 | WP_109989459.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QBQ48_RS20005 (QBQ48_20005) | 1603399..1603686 | + | 288 | WP_280135262.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QBQ48_RS20010 (QBQ48_20010) | 1603698..1604030 | - | 333 | Protein_1445 | zincin-like metallopeptidase domain-containing protein | - |
| QBQ48_RS20015 (QBQ48_20015) | 1604278..1604559 | - | 282 | WP_280135263.1 | hypothetical protein | - |
| QBQ48_RS20020 (QBQ48_20020) | 1604653..1605102 | + | 450 | WP_280135264.1 | hypothetical protein | - |
| QBQ48_RS20025 (QBQ48_20025) | 1605073..1605237 | - | 165 | Protein_1448 | transposase | - |
| QBQ48_RS20030 (QBQ48_20030) | 1605301..1605963 | - | 663 | WP_280135265.1 | carbonic anhydrase | - |
| QBQ48_RS20035 (QBQ48_20035) | 1606008..1606415 | - | 408 | WP_021586717.1 | response regulator | - |
| QBQ48_RS20040 (QBQ48_20040) | 1606830..1608251 | + | 1422 | WP_112592890.1 | ISNCY family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1606830..1608251 | 1421 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11111.92 Da Isoelectric Point: 10.6292
>T278600 WP_280135262.1 NZ_CP123057:1603399-1603686 [Brucella intermedia]
MPYKLEFLPSALKEWNKLGSTIREQLKKKLRERLETPRVVSASLYGMPDHYKIKLRQLGYRLVYSVNDDTVTVLVVAVGR
RERGDVYNTARTRTQ
MPYKLEFLPSALKEWNKLGSTIREQLKKKLRERLETPRVVSASLYGMPDHYKIKLRQLGYRLVYSVNDDTVTVLVVAVGR
RERGDVYNTARTRTQ
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|