Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ-RelB |
Location | 400438..401009 | Replicon | chromosome |
Accession | NZ_CP123050 | ||
Organism | Bifidobacterium adolescentis strain iVS-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QEP23_RS01540 | Protein ID | WP_003807675.1 |
Coordinates | 400438..400737 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0C2Z6P7 |
Locus tag | QEP23_RS01545 | Protein ID | WP_034984155.1 |
Coordinates | 400737..401009 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QEP23_RS01530 (QEP23_01530) | 397133..397861 | + | 729 | WP_042989841.1 | type 1 glutamine amidotransferase | - |
QEP23_RS01535 (QEP23_01535) | 398173..400341 | + | 2169 | WP_042989842.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
QEP23_RS01540 (QEP23_01540) | 400438..400737 | - | 300 | WP_003807675.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
QEP23_RS01545 (QEP23_01545) | 400737..401009 | - | 273 | WP_034984155.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
QEP23_RS01550 (QEP23_01550) | 401123..401959 | - | 837 | WP_042989843.1 | hypothetical protein | - |
QEP23_RS01555 (QEP23_01555) | 402143..402682 | + | 540 | WP_003807679.1 | hypothetical protein | - |
QEP23_RS01560 (QEP23_01560) | 402675..403193 | + | 519 | WP_130082043.1 | hypothetical protein | - |
QEP23_RS01565 (QEP23_01565) | 403252..404406 | - | 1155 | WP_046998989.1 | ATP-binding protein | - |
QEP23_RS01570 (QEP23_01570) | 404409..405038 | - | 630 | WP_003807685.1 | response regulator transcription factor | - |
QEP23_RS01575 (QEP23_01575) | 405205..405816 | + | 612 | WP_236836162.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11662.09 Da Isoelectric Point: 8.0955
>T278598 WP_003807675.1 NZ_CP123050:c400737-400438 [Bifidobacterium adolescentis]
MGRLTADFAKAFSRDLKKNAKRRNWNLTELEKVIDLVVENTPETLEELRRRHNMHTLSGNWRGRYECHVANAGDWLVIWS
SNDSVAFFERTGSHDELFR
MGRLTADFAKAFSRDLKKNAKRRNWNLTELEKVIDLVVENTPETLEELRRRHNMHTLSGNWRGRYECHVANAGDWLVIWS
SNDSVAFFERTGSHDELFR
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|