Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 79299..79824 Replicon plasmid pEC0430-2
Accession NZ_CP123048
Organism Escherichia coli strain EC0430

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag QDU34_RS24720 Protein ID WP_001159871.1
Coordinates 79519..79824 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag QDU34_RS24715 Protein ID WP_000813630.1
Coordinates 79299..79517 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDU34_RS24695 (75115) 75115..75384 - 270 WP_000379710.1 SemiSWEET transporter -
QDU34_RS24700 (75386) 75386..76402 - 1017 WP_016230896.1 Gfo/Idh/MocA family oxidoreductase -
QDU34_RS24705 (76402) 76402..77232 - 831 WP_016230897.1 HAD-IIB family hydrolase -
QDU34_RS24710 (77216) 77216..78454 - 1239 WP_024188128.1 DegT/DnrJ/EryC1/StrS family aminotransferase -
QDU34_RS24715 (79299) 79299..79517 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QDU34_RS24720 (79519) 79519..79824 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
QDU34_RS24725 (79825) 79825..80634 + 810 WP_280102452.1 site-specific integrase -
QDU34_RS24730 (80807) 80807..81160 + 354 WP_000864812.1 colicin M immunity protein -
QDU34_RS24735 (81210) 81210..82025 - 816 WP_000449473.1 lipid II-degrading bacteriocin colicin M -
QDU34_RS24740 (82268) 82268..82795 + 528 WP_000203268.1 colicin B immunity protein -
QDU34_RS24745 (82813) 82813..84348 - 1536 WP_001282376.1 pore-forming bacteriocin colicin B -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / aadA5 / qacE / sul1 - 1..114815 114815


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T278595 WP_001159871.1 NZ_CP123048:79519-79824 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT278595 WP_000813630.1 NZ_CP123048:79299-79517 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References