Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 96840..97375 Replicon plasmid pEC0430-1
Accession NZ_CP123047
Organism Escherichia coli strain EC0430

Toxin (Protein)


Gene name relE Uniprot ID V0VJJ7
Locus tag QDU34_RS23710 Protein ID WP_000222760.1
Coordinates 97088..97375 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag QDU34_RS23705 Protein ID WP_001132900.1
Coordinates 96840..97091 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QDU34_RS23660 (91966) 91966..92526 + 561 WP_000139315.1 fertility inhibition protein FinO -
QDU34_RS23665 (92662) 92662..92874 + 213 WP_001299730.1 ANR family transcriptional regulator -
QDU34_RS23670 (93120) 93120..93194 + 75 Protein_93 endonuclease -
- (93450) 93450..93511 - 62 NuclAT_1 - -
- (93450) 93450..93511 - 62 NuclAT_1 - -
- (93450) 93450..93511 - 62 NuclAT_1 - -
- (93450) 93450..93511 - 62 NuclAT_1 - -
QDU34_RS23675 (93555) 93555..93704 + 150 WP_001312851.1 Hok/Gef family protein -
QDU34_RS23680 (93988) 93988..94245 + 258 WP_000083845.1 replication regulatory protein RepA -
QDU34_RS23685 (94262) 94262..94513 - 252 WP_223195197.1 replication protein RepA -
QDU34_RS23690 (94504) 94504..94551 + 48 WP_229471593.1 hypothetical protein -
QDU34_RS23695 (94544) 94544..95026 + 483 WP_001273588.1 hypothetical protein -
QDU34_RS23700 (95019) 95019..95876 + 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
QDU34_RS23705 (96840) 96840..97091 + 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QDU34_RS23710 (97088) 97088..97375 + 288 WP_000222760.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QDU34_RS23715 (97479) 97479..97799 + 321 Protein_102 serine acetyltransferase -
QDU34_RS23720 (97815) 97815..98162 - 348 Protein_103 IS1-like element IS1A family transposase -
QDU34_RS23725 (98251) 98251..99273 + 1023 WP_000255956.1 IS21-like element IS100 family transposase -
QDU34_RS23730 (99270) 99270..100052 + 783 WP_001442137.1 IS21-like element IS100kyp family helper ATPase IstB -
QDU34_RS23735 (100107) 100107..100471 - 365 Protein_106 IS1 family transposase -
QDU34_RS23740 (100571) 100571..101792 + 1222 Protein_107 ISL3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iucA / iucB / iucC / iucD / iutA / vat / iroN / iroE / iroD / iroC / iroB 1..207503 207503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11105.15 Da        Isoelectric Point: 10.5832

>T278591 WP_000222760.1 NZ_CP123047:97088-97375 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT278591 WP_001132900.1 NZ_CP123047:96840-97091 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0VJJ7

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References