Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 82863..83488 | Replicon | plasmid pEC0430-1 |
Accession | NZ_CP123047 | ||
Organism | Escherichia coli strain EC0430 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QDU34_RS23625 | Protein ID | WP_000911333.1 |
Coordinates | 82863..83261 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | QDU34_RS23630 | Protein ID | WP_000450520.1 |
Coordinates | 83261..83488 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QDU34_RS23610 (79194) | 79194..79703 | + | 510 | WP_000628105.1 | conjugal transfer entry exclusion protein TraS | - |
QDU34_RS23615 (79717) | 79717..80448 | + | 732 | WP_000850416.1 | conjugal transfer complement resistance protein TraT | - |
QDU34_RS23620 (80701) | 80701..82854 | + | 2154 | WP_000009379.1 | type IV conjugative transfer system coupling protein TraD | - |
QDU34_RS23625 (82863) | 82863..83261 | - | 399 | WP_000911333.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QDU34_RS23630 (83261) | 83261..83488 | - | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QDU34_RS23635 (83570) | 83570..84106 | + | 537 | Protein_86 | MobF family relaxase | - |
QDU34_RS23640 (84206) | 84206..85414 | + | 1209 | WP_001352368.1 | IS4-like element ISVsa5 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iucA / iucB / iucC / iucD / iutA / vat / iroN / iroE / iroD / iroC / iroB | 1..207503 | 207503 | |
- | flank | IS/Tn | - | - | 84206..85414 | 1208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14919.19 Da Isoelectric Point: 7.8605
>T278590 WP_000911333.1 NZ_CP123047:c83261-82863 [Escherichia coli]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|